Explore
Validate
LearnH00007291-M01
antibody from Abnova Corporation
Targeting: TWIST1
ACS3, bHLHa38, BPES2, BPES3, CRS, CRS1, H-twist, SCS, TWIST
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007291-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007291-M01, RRID:AB_489953
- Product name
- TWIST1 monoclonal antibody (M01), clone 3E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TWIST1.
- Antigen sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKI
IPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELD
SKMASCSYVAHERLSYAFSVWRMEGAWSMSASH- Isotype
- IgG
- Antibody clone number
- 3E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cellular migration and invasion uncoupled: increased migration is not an inexorable consequence of epithelial-to-mesenchymal transition.
EMT and induction of miR-21 mediate metastasis development in Trp53-deficient tumours.
Conversion of Helicobacter pylori CagA from senescence inducer to oncogenic driver through polarity-dependent regulation of p21.
Schaeffer D, Somarelli JA, Hanna G, Palmer GM, Garcia-Blanco MA
Molecular and cellular biology 2014 Sep 15;34(18):3486-99
Molecular and cellular biology 2014 Sep 15;34(18):3486-99
EMT and induction of miR-21 mediate metastasis development in Trp53-deficient tumours.
Bornachea O, Santos M, Martínez-Cruz AB, García-Escudero R, Dueñas M, Costa C, Segrelles C, Lorz C, Buitrago A, Saiz-Ladera C, Agirre X, Grande T, Paradela B, Maraver A, Ariza JM, Prosper F, Serrano M, Sánchez-Céspedes M, Paramio JM
Scientific reports 2012;2:434
Scientific reports 2012;2:434
Conversion of Helicobacter pylori CagA from senescence inducer to oncogenic driver through polarity-dependent regulation of p21.
Saito Y, Murata-Kamiya N, Hirayama T, Ohba Y, Hatakeyama M
The Journal of experimental medicine 2010 Sep 27;207(10):2157-74
The Journal of experimental medicine 2010 Sep 27;207(10):2157-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody (M01), clone 3E11.Lane 1: TWIST1 transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TWIST1 monoclonal antibody (M01), clone 3E11. Western Blot analysis of TWIST1 expression in rat testis.
