HPA026085

ARMC1 antibody from Sigma-Aldrich
Arcp, FLJ10511
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026085
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026085, RRID:AB_1845031
Product name
Anti-ARMC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026085
Antibody type
Polyclonal
Antigen
Armadillo repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQD
QGCLPGLILFMDHPNPPVVHSALLALRYLAECRAN
REKMKGELGMMLSLQNVIQKTTTPGETKLLASEIY
DILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRA
Storage
-20C
Provider Type Product Number
- No reagents -