HPA002356

TRAT1 antibody from Sigma-Aldrich
HSPC062, TCRIM, TRIM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002356, RRID:AB_1080375
Product name
Anti-TRAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002356
Antibody type
Polyclonal
Antigen
T-cell receptor-associated transmembrane adapter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISE
PMDENCYEQMKARPEKSVNKMQEATPSAQATNETQ
MCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHA
I
Storage
-20C
Provider Type Product Number
- No reagents -