HPA020103

MACC1 antibody from Sigma-Aldrich
7A5, SH3BP4L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020103
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020103, RRID:AB_1844387
Product name
Anti-MACC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020103
Antibody type
Polyclonal
Antigen
SH3 domain-containing protein 7a5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDP
DLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
Storage
-20C
Provider Type Product Number
- No reagents -