Antibody data

Product number
H00065110-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00065110-M06, RRID:AB_1237902
Product name
UPF3A monoclonal antibody (M06), clone 2E2
Provider product page
Abnova Corporation - H00065110-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UPF3A.
Antigen sequence
TGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGS
DKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPE
RLSRRSEDEQRWGKGPGQDRGKKGSQDSGAP
Isotype
IgG
Antibody clone number
2E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -