Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28557 - Provider product page

- Provider
- Abnova Corporation
- Product name
- SLMAP polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SLMAP.
- Antigen sequence
TTDAQMDEQDLNEPLAKVSLLKALLEEERKAYRNQ
VEESTKQIQVLQAQLQRLHIDTENLREEKDSEITS
TRDELL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with SLMAP polyclonal antibody (PAB28557).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human smooth muscle with SLMAP polyclonal antibody (Cat # PAB28557) shows strong nuclear and cytoplasmic positivity in smooth muscle cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)