Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026975 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026975, RRID:AB_10602007
- Product name
- Anti-ABCB5
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQD
IKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFI
DKAEESTQSKEISLPEVSLL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The β Isoform of Human ATP-Binding Cassette B5 Transporter, ABCB5β, Localizes to the Endoplasmic Reticulum.
Clinical risk scores for stroke correlate with molecular signatures of vulnerability in symptomatic carotid patients
Sphere-forming corneal cells repopulate dystrophic keratoconic stroma: Implications for potential therapy
Sphere-forming cells from peripheral cornea demonstrate the ability to repopulate the ocular surface
Derivation of Corneal Keratocyte-Like Cells from Human Induced Pluripotent Stem Cells
The helicase HAGE prevents interferon-α-induced PML expression in ABCB5+ malignant melanoma-initiating cells by promoting the expression of SOCS1
ABCB5 expression and cancer stem cell hypothesis in oral squamous cell carcinoma
The Helicase HAGE Expressed by Malignant Melanoma-Initiating Cells Is Required for Tumor Cell Proliferation in Vivo
Díaz-Anaya AM, Gerard L, Albert M, Gaussin JF, Boonen M, Gillet JP
International journal of molecular sciences 2023 Oct 31;24(21)
International journal of molecular sciences 2023 Oct 31;24(21)
Clinical risk scores for stroke correlate with molecular signatures of vulnerability in symptomatic carotid patients
Wadén K, Karlöf E, Narayanan S, Lengquist M, Hansson G, Hedin U, Roy J, Matic L
iScience 2022;25(5):104219
iScience 2022;25(5):104219
Sphere-forming corneal cells repopulate dystrophic keratoconic stroma: Implications for potential therapy
Wadhwa H, Ismail S, McGhee J, Werf B, Sherwin T
World Journal of Stem Cells 2020;12(1):35-54
World Journal of Stem Cells 2020;12(1):35-54
Sphere-forming cells from peripheral cornea demonstrate the ability to repopulate the ocular surface
Mathan J, Ismail S, McGhee J, McGhee C, Sherwin T
Stem Cell Research & Therapy 2016;7(1)
Stem Cell Research & Therapy 2016;7(1)
Derivation of Corneal Keratocyte-Like Cells from Human Induced Pluripotent Stem Cells
Ljubimov A, Naylor R, McGhee C, Cowan C, Davidson A, Holm T, Sherwin T
PLOS ONE 2016;11(10):e0165464
PLOS ONE 2016;11(10):e0165464
The helicase HAGE prevents interferon-α-induced PML expression in ABCB5+ malignant melanoma-initiating cells by promoting the expression of SOCS1
Mathieu M, Miles A, Ahmad M, Buczek M, Pockley A, Rees R, Regad T
Cell Death & Disease 2014;5(2):e1061-e1061
Cell Death & Disease 2014;5(2):e1061-e1061
ABCB5 expression and cancer stem cell hypothesis in oral squamous cell carcinoma
Grimm M, Krimmel M, Polligkeit J, Alexander D, Munz A, Kluba S, Keutel C, Hoffmann J, Reinert S, Hoefert S
European Journal of Cancer 2012;48(17):3186-3197
European Journal of Cancer 2012;48(17):3186-3197
The Helicase HAGE Expressed by Malignant Melanoma-Initiating Cells Is Required for Tumor Cell Proliferation in Vivo
Linley A, Mathieu M, Miles A, Rees R, McArdle S, Regad T
Journal of Biological Chemistry 2012;287(17):13633-13643
Journal of Biological Chemistry 2012;287(17):13633-13643
No comments: Submit comment
No validations: Submit validation data