Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026975 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026975, RRID:AB_10602007
- Product name
- Anti-ABCB5
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQD
IKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFI
DKAEESTQSKEISLPEVSLL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The helicase HAGE prevents interferon-α-induced PML expression in ABCB5+ malignant melanoma-initiating cells by promoting the expression of SOCS1.
ABCB5 expression and cancer stem cell hypothesis in oral squamous cell carcinoma
The helicase HAGE expressed by malignant melanoma-initiating cells is required for tumor cell proliferation in vivo.
Mathieu MG, Miles AK, Ahmad M, Buczek ME, Pockley AG, Rees RC, Regad T
Cell death & disease 2014 Feb 13;5(2):e1061
Cell death & disease 2014 Feb 13;5(2):e1061
ABCB5 expression and cancer stem cell hypothesis in oral squamous cell carcinoma
Grimm M, Krimmel M, Polligkeit J, Alexander D, Munz A, Kluba S, Keutel C, Hoffmann J, Reinert S, Hoefert S
European Journal of Cancer 2012 November;48(17):3186-3197
European Journal of Cancer 2012 November;48(17):3186-3197
The helicase HAGE expressed by malignant melanoma-initiating cells is required for tumor cell proliferation in vivo.
Linley AJ, Mathieu MG, Miles AK, Rees RC, McArdle SE, Regad T
The Journal of biological chemistry 2012 Apr 20;287(17):13633-43
The Journal of biological chemistry 2012 Apr 20;287(17):13633-43
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong granular positivity in glandular cells.