HPA026975

ABCB5 antibody from Sigma-Aldrich
ABCB5alpha, ABCB5beta, EST422562
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026975
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026975, RRID:AB_10602007
Product name
Anti-ABCB5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026975
Antibody type
Polyclonal
Antigen
ATP-binding cassette, sub-family B (MDR/TAP), member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQD
IKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFI
DKAEESTQSKEISLPEVSLL
Storage
-20C
Provider Type Product Number
- No reagents -