ABIN183403

KCTD11 antibody from antibodies-online
C17orf36, KCASH1, REN

Antibody data

Product number
ABIN183403
Provider
antibodies-online
Product name
anti-Potassium Channel Tetramerisation Domain Containing 11 (KCTD11) antibody
Provider product page
antibodies-online - ABIN183403
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11
Reactivity
Human
Host
Rabbit
Antigen sequence
ADFYQIRPLLDALRELEASQGTPAPTAALLHADVD
VSPRL VHFSARRGPH
Vial size
0.1 mg
Provider Type Product Number
- No reagents -