HPA052035

KCTD11 antibody from Atlas Antibodies
C17orf36, KCASH1, REN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052035
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052035, RRID:AB_2681704
Product name
Anti-KCTD11
Provider product page
Atlas Antibodies - HPA052035
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DALRELEASQGTPAPTAALLHADVDVSPRLVHFSA
RRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR
FGVAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -