HPA003245

ABLIM3 antibody from Sigma-Aldrich
KIAA0843
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003245
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003245, RRID:AB_1078083
Product name
Anti-ABLIM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003245
Antibody type
Polyclonal
Antigen
Actin-binding LIM protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESE
YWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSG
IGRLILKEEMKARSSSYADPWTPPRSSTSSREALH
TAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRR
NGLHRT
Storage
-20C
Provider Type Product Number
- No reagents -