HPA002473

GCSAM antibody from Sigma-Aldrich
GCET2, HGAL, MGC40441
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002473
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002473, RRID:AB_1078960
Product name
Anti-GCET2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002473
Antibody type
Polyclonal
Antigen
Germinal center B-cell-expressed transcript 2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPI
QDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYY
ENVPCKAERPRESLGGTETEYSLLHMPSTDPRHAR
SPEDEYELLMPHRISSHFL
Storage
-20C
Provider Type Product Number
- No reagents -