H00023204-M09

ARL6IP1 antibody from Abnova Corporation
AIP1, ARL6IP, ARMER, KIAA0069, SPG61
No application information provided.

Antibody data

Product number
H00023204-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023204-M09, RRID:AB_1571381
Product name
ARL6IP monoclonal antibody (M09), clone 4F9
Provider product page
Abnova Corporation - H00023204-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ARL6IP.
Antigen sequence
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADK
VLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGV
SCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRF
HEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMT
MIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLN
QHGIILKYIGMAKREINKLLKQKEKKNE
Isotype
IgG
Antibody clone number
4F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -