H00023204-B02P

ARL6IP1 antibody from Abnova Corporation
AIP1, ARL6IP, ARMER, KIAA0069, SPG61

Antibody data

Product number
H00023204-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023204-B02P, RRID:AB_1571382
Product name
ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00023204-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ARL6IP1 protein.
Antigen sequence
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADK
VLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGV
SCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRF
HEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMT
MIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLN
QHGIILKYIGMAKREINKLLKQKEKKNE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -