Antibody data
- Product number
- HPA021088
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021088, RRID:AB_1858986
- Product name
- Anti-ZCCHC7
- Provider product page
- Atlas Antibodies - HPA021088
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQL
YSQIHYAQDLDDVIREEEHEEKNSGNSESSSSKPN
QKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKG
KNVRVQAQENAH
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ZCCHC7 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows moderate positivity in tubular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows strong positivity in nucleoli in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows strong positivity in nucleoli in cells in tubules.
- Sample type
- HUMAN