HPA020600

ZCCHC7 antibody from Sigma-Aldrich
AIR1, FLJ22611
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020600, RRID:AB_1858985
Product name
Anti-ZCCHC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020600
Antibody type
Polyclonal
Antigen
Zinc finger CCHC domain-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNRWPQENKETQKEMKNKNRNWEKHRKADRHREVD
EDFPRGPKTYSSPGSFKTQKPSKPFHRSSHYHTSR
EDKSPKEGKRGKQKKKERCWEDDDNDNLFLIKQ
Storage
-20C
Provider Type Product Number
- No reagents -