HPA024433

TMEM102 antibody from Atlas Antibodies
CBAP, FLJ36878
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024433
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024433, RRID:AB_1858071
Product name
Anti-TMEM102
Provider product page
Atlas Antibodies - HPA024433
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDL
ESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARD
SIHRTESEESSKDWQSSVDQPHSYVTEHE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -