HPA024433

TMEM102 antibody from Sigma-Aldrich
CBAP, FLJ36878
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024433
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024433, RRID:AB_1858071
Product name
Anti-TMEM102 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024433
Antibody type
Polyclonal
Antigen
Transmembrane protein 102 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDL
ESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARD
SIHRTESEESSKDWQSSVDQPHSYVTEHE
Storage
-20C
Provider Type Product Number
- No reagents -