HPA002375

STAP2 antibody from Sigma-Aldrich
BKS, STAP-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002375
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002375, RRID:AB_1078285
Product name
Anti-STAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002375
Antibody type
Polyclonal
Antigen
signal-transducing adaptor protein-2 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGE
NVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPL
PPLPNQEENYVTPIGDGPAVDYENQDVASSS
Storage
-20C
Provider Type Product Number
- No reagents -