HPA027761

STAP2 antibody from Sigma-Aldrich
BKS, STAP-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027761, RRID:AB_1845364
Product name
Anti-STAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027761
Antibody type
Polyclonal
Antigen
signal transducing adaptor family member 2 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWG
SSRDPGTHFSLILRNQEIKFKVETLECREMWKGFI
LTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRAL
ETPSCFLKVSRLEAQLLLE
Storage
-20C
Provider Type Product Number
- No reagents -