HPA003462

LAT2 antibody from Sigma-Aldrich
HSPC046, LAB, NTAL, WBSCR15, WBSCR5, WSCR5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003462
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003462, RRID:AB_1079238
Product name
Anti-LAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003462
Antibody type
Polyclonal
Antigen
Linker for activation of T-cells family member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPG
PLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGS
RHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYE
NVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKT
GPT
Storage
-20C
Provider Type Product Number
- No reagents -