HPA022971

GRHPR antibody from Atlas Antibodies
GLXR, PH2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022971
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022971, RRID:AB_1849975
Product name
Anti-GRHPR
Provider product page
Atlas Antibodies - HPA022971
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLA
GLRGEPMPSELKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -