HPA022971

GRHPR antibody from Atlas Antibodies
GLXR, PH2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022971
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022971, RRID:AB_1849975
Product name
Anti-GRHPR
Provider product page
Atlas Antibodies - HPA022971
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLA
GLRGEPMPSELKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -