HPA022971

GRHPR antibody from Sigma-Aldrich
GLXR, PH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022971
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022971, RRID:AB_1849975
Product name
Anti-GRHPR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022971
Antibody type
Polyclonal
Antigen
Glyoxylate reductase/hydroxypyruvate reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLA
GLRGEPMPSELKL
Storage
-20C
Provider Type Product Number
- No reagents -