Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001392-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001392-M02, RRID:AB_875506
- Product name
- CRH monoclonal antibody (M02), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRH.
- Antigen sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNR
KLMEIIGK- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Negative effects of progesterone receptor isoform-A on human placental activity of the noncanonical NF-κB signaling.
Glucocorticoid receptor signaling contributes to constitutive activation of the noncanonical NF-κB pathway in term human placenta.
RelB/NF-κB2 regulates corticotropin-releasing hormone in the human placenta.
Wang B, Parobchak N, Rosen M, Roche N, Rosen T
The Journal of clinical endocrinology and metabolism 2014 Feb;99(2):E320-8
The Journal of clinical endocrinology and metabolism 2014 Feb;99(2):E320-8
Glucocorticoid receptor signaling contributes to constitutive activation of the noncanonical NF-κB pathway in term human placenta.
Wang B, Palomares K, Parobchak N, Cece J, Rosen M, Nguyen A, Rosen T
Molecular endocrinology (Baltimore, Md.) 2013 Feb;27(2):203-11
Molecular endocrinology (Baltimore, Md.) 2013 Feb;27(2):203-11
RelB/NF-κB2 regulates corticotropin-releasing hormone in the human placenta.
Wang B, Parobchak N, Rosen T
Molecular endocrinology (Baltimore, Md.) 2012 Aug;26(8):1356-69
Molecular endocrinology (Baltimore, Md.) 2012 Aug;26(8):1356-69
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11.Lane 1: CRH transfected lysate(21.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CRH is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol