HPA023062

ADHFE1 antibody from Sigma-Aldrich
ADHFe1, FLJ32430
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023062
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023062, RRID:AB_1844611
Product name
Anti-ADHFE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023062
Antibody type
Polyclonal
Antigen
Hydroxyacid-oxoacid transhydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEMAEILGADTRTARIQDAGLVLADTLRKFLFDLD
VDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCP
QSEEDLAALFEASMKL
Storage
-20C
Provider Type Product Number
- No reagents -