SAB2100061

ADHFE1 antibody from Sigma-Aldrich
ADHFe1, FLJ32430
No application information provided.

Antibody data

Product number
SAB2100061
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100061, RRID:AB_10605955
Product name
Anti-ADHFE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100061
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_653251.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFG
NAGVHLCHGMSYPIS
Storage
-20C
Provider Type Product Number
- No reagents -