HPA006344

AKAP12 antibody from Sigma-Aldrich
AKAP250, SSeCKS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006344, RRID:AB_1078118
Product name
Anti-AKAP12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006344
Antibody type
Polyclonal
Antigen
A-kinase anchor protein 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTE
PFTQGKVVGQTTPESFEKAPQVTESIESSELVTTC
QAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGS
T
Storage
-20C
Provider Type Product Number
- No reagents -