HPA027169

CDCA7L antibody from Atlas Antibodies
JPO2, R1, RAM2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027169
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027169, RRID:AB_1856058
Product name
Anti-CDCA7L
Provider product page
Atlas Antibodies - HPA027169
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDL
NGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDK
ATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSS
SEQLFSSARLQNEKKTILERKKDCRQVIQREDSTS
ESE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -