H00055320-B01P

MIS18BP1 antibody from Abnova Corporation
C14orf106, FLJ11186, KIAA1903, KNL2, M18BP1

Antibody data

Product number
H00055320-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055320-B01P, RRID:AB_1237749
Product name
C14orf106 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055320-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C14orf106 protein.
Antigen sequence
MIATPLKHSRIYLPPEASSQRRNLPMDAIFFDSIP
SGTLTPVKDLVKYQNSSLKLNDHKKNQFLKMTTFN
NKNIFQSTMLTEATTSNSSLDISAIKPNKDGLKNK
ANYESPGKIFLRMKEKVLRDKQEQPSRNSSLLEPQ
KSGNNETFTPNRVEKKKLQHTYLCEEKENNKSFQS
DDSSLRASVQGVPLESSNNDIFLPVKQKIQCQQEK
KAPLHNLTYELPTLNQEQENFLAVEARNKTLTRAQ
LAKQIFHSKESIVATTKSKKDTFVLESVDSADEQF
QNTNAETLSTNCIPIKNGSLLMVSDSERTTEGTS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -