HPA006504

MIS18BP1 antibody from Sigma-Aldrich
C14orf106, FLJ11186, KIAA1903, KNL2, M18BP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006504
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006504, RRID:AB_1078317
Product name
Anti-C14orf106 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006504
Antibody type
Polyclonal
Antigen
Mis18-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QHQRILLPSFQDSEDDDDILPNMDKNPTTPSSVIF
PLVKTPQCQHVSPGMLGSINRNDCDKYVFRMQKYH
KSNGGIVWGNIKKKLVETDFSTPTPRRKTPFNTDL
GENSGIGKLFTNAVESLDE
Storage
-20C
Provider Type Product Number
- No reagents -