HPA002569

C14orf93 antibody from Sigma-Aldrich
FLJ12154
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002569
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002569, RRID:AB_1078334
Product name
Anti-C14orf93 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002569
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf93 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLRQGKVSIPDEDGESRAHSSPPEEPGPLKESPGE
AFKALSAVEEECDSVGSGVQVVIEELRQLGAASVG
PGPLGFPATQRDMRLPGCTLAASEAAPLLNPLVDD
YVASEGAVQRVLVPAYAKQLSPATQLAIQRATPET
GPENGTKL
Storage
-20C
Provider Type Product Number
- No reagents -