HPA004706

PLEKHA2 antibody from MilliporeSigma / Merck KGaA
TAPP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004706
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA004706, RRID:AB_1079633
Product name
Anti-PLEKHA2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA004706
Antibody type
Polyclonal
Antigen
Pleckstrin homology domain-containing family A member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAGAVGALQLTYISKVSIATPKQKPKTPFCFVINA
LSQRYFLQANDQKDMKDWVEALNQASKITVPKGGG
LPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVV
HTPISQNGGDGQEGSEPGSHTILRRSQSYIPTS
Storage
-20C
Provider Type Product Number
- No reagents -