Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001436-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001436-M02, RRID:AB_804933
- Product name
- CSF1R monoclonal antibody (M02), clone 3G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSF1R.
- Antigen sequence
PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPS
PHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDP
LGGSAAIHLYVKDPARPWNVLAQEVVVFED- Isotype
- IgG
- Antibody clone number
- 3G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CSF1R monoclonal antibody (M02), clone 3G12 Western Blot analysis of CSF1R expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CSF1R is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and CSF1R. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)