HPA012323

CSF1R antibody from Sigma-Aldrich
C-FMS, CD115, CSFR, FMS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012323
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012323, RRID:AB_1848977
Product name
Anti-CSF1R antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012323
Antibody type
Polyclonal
Antigen
Macrophage colony-stimulating factor 1 receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLD
QVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYL
NLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNW
TYLGPFSDHQP
Storage
-20C
Provider Type Product Number
- No reagents -