HPA012323

CSF1R antibody from Atlas Antibodies
C-FMS, CD115, CSFR, FMS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012323
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012323, RRID:AB_1848977
Product name
Anti-CSF1R
Provider product page
Atlas Antibodies - HPA012323
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLD
QVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYL
NLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNW
TYLGPFSDHQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -