HPA012323

CSF1R antibody from Atlas Antibodies
C-FMS, CD115, CSFR, FMS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012323
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012323, RRID:AB_1234354
Product name
Anti-CSF1R
Provider product page
Atlas Antibodies - HPA012323
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLD
QVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYL
NLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNW
TYLGPFSDHQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -