HPA022527

POLR1E antibody from Sigma-Aldrich
FLJ13390, FLJ13970, PAF53, PRAF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022527
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022527, RRID:AB_1854924
Product name
Anti-POLR1E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022527
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerase I subunit RPA49 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLQFPLGQDPSFLAIPILALPPSDSLVPPYIVWYI
VWPSALISFLGCTLTVQFSNGKLQSPGNMRFTLYE
NKDSTNPRKRNQRILAAETDRLSYVGNNFG
Storage
-20C
Provider Type Product Number
- No reagents -