Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007262-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007262-M01, RRID:AB_464143
- Product name
- PHLDA2 monoclonal antibody (M01), clone 5E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PHLDA2.
- Antigen sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDR
LSLFPASPRARPKELRFHSILKVDCVERTGKYVYF
TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRR
ALQDF- Isotype
- IgG
- Antibody clone number
- 5E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterisation of marsupial PHLDA2 reveals eutherian specific acquisition of imprinting.
Suzuki S, Shaw G, Kaneko-Ishino T, Ishino F, Renfree MB
BMC evolutionary biology 2011 Aug 19;11:244
BMC evolutionary biology 2011 Aug 19;11:244
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PHLDA2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol