HPA003994

PHLDA2 antibody from Sigma-Aldrich
BWR1C, HLDA2, IPL, TSSC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003994
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003994, RRID:AB_1855311
Product name
Anti-PHLDA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003994
Antibody type
Polyclonal
Antigen
Pleckstrin homology-like domain family A member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPR
ARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKE
IDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQ
ERTA
Storage
-20C
Provider Type Product Number
- No reagents -