HPA023505

ATF7IP antibody from Atlas Antibodies
FLJ10688, p621
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA023505
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023505, RRID:AB_1845148
Product name
Anti-ATF7IP
Provider product page
Atlas Antibodies - HPA023505
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SMEIDQGEKNEDETSADLVETINENVIEDNKSENI
LENTDSMETDEIIPILEKLAPSEDELTCFSKTSLL
PIDETNPDLEEKMESSFGSPSKQESSESLPKEAFL
VLSDEEDISGEKDESEVISQNETCSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -