HPA016578

ATF7IP antibody from Sigma-Aldrich
FLJ10688, p621
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016578
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016578, RRID:AB_1845147
Product name
Anti-ATF7IP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016578
Antibody type
Polyclonal
Antigen
Activating transcription factor 7-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YKVKEELLKTDVKLLNGNHENGDLDPTSPLENMDY
IKDKEEVNGIEEICFDPEGSKAEWKETPCILSVNV
KNKQDDDLNCEPLSPHNITPEPVSKLPAEPVSGDP
APGDLDAG
Storage
-20C
Provider Type Product Number
- No reagents -