HPA023505

ATF7IP antibody from Sigma-Aldrich
FLJ10688, p621
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023505
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023505, RRID:AB_1845148
Product name
Anti-ATF7IP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023505
Antibody type
Polyclonal
Antigen
Activating transcription factor 7-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SMEIDQGEKNEDETSADLVETINENVIEDNKSENI
LENTDSMETDEIIPILEKLAPSEDELTCFSKTSLL
PIDETNPDLEEKMESSFGSPSKQESSESLPKEAFL
VLSDEEDISGEKDESEVISQNETCSP
Storage
-20C
Provider Type Product Number
- No reagents -