H00005595-M04

MAPK3 antibody from Abnova Corporation
ERK1, p44erk1, p44mapk, PRKM3

Antibody data

Product number
H00005595-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005595-M04, RRID:AB_1137296
Product name
MAPK3 monoclonal antibody (M04), clone 1F7
Provider product page
Abnova Corporation - H00005595-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAPK3.
Antigen sequence
NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTF
NPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTF
AMELDDLPKERLKELIFQETARFQPGVLEAP
Isotype
IgG
Antibody clone number
1F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -