H00005595-M05

MAPK3 antibody from Abnova Corporation
ERK1, p44erk1, p44mapk, PRKM3

Antibody data

Product number
H00005595-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005595-M05, RRID:AB_1204660
Product name
MAPK3 monoclonal antibody (M05), clone 3D6
Provider product page
Abnova Corporation - H00005595-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAPK3.
Antigen sequence
NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTF
NPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTF
AMELDDLPKERLKELIFQETARFQPGVLEAP
Isotype
IgG
Antibody clone number
3D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -