Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005595-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005595-M05, RRID:AB_1204660
- Product name
- MAPK3 monoclonal antibody (M05), clone 3D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPK3.
- Antigen sequence
NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTF
NPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTF
AMELDDLPKERLKELIFQETARFQPGVLEAP- Isotype
- IgG
- Antibody clone number
- 3D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in Raw 264.7(Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody (M05), clone 3D6.Lane 1: MAPK3 transfected lysate(43.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MAPK3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol