HPA005700

MAPK3 antibody from Sigma-Aldrich
ERK1, p44erk1, p44mapk, PRKM3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005700, RRID:AB_1078750
Product name
Anti-MAPK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005700
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYD
HVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFR
HENVIGIRDILRASTLEAMRDVYIVQDLMETDLYK
LLKSQQLSNDHICYFLYQILRGLKYI
Storage
-20C
Provider Type Product Number
- No reagents -