Antibody data

Product number
H00027166-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027166-M01, RRID:AB_534999
Product name
PX19 monoclonal antibody (M01), clone 7B4
Provider product page
Abnova Corporation - H00027166-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PX19.
Antigen sequence
KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTE
DIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPA
NVAHSVYVLEDSIVDPQNQTMTTFTWNI
Isotype
IgG
Antibody clone number
7B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.