H00027166-A01

PRELID1 antibody from Abnova Corporation
CGI-106, PRELI, PX19
No application information provided.

Antibody data

Product number
H00027166-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027166-A01, RRID:AB_606896
Product name
PX19 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00027166-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant PX19.
Antigen sequence
KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTE
DIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPA
NVAHSVYVLEDSIVDPQNQTMTTFTWNI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.