HPA005701

PRELID1 antibody from Atlas Antibodies
CGI-106, PRELI, PX19

Antibody data

Product number
HPA005701
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005701, RRID:AB_1079721
Product name
Anti-PRELID1
Provider product page
Atlas Antibodies - HPA005701
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVV
EERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAV
QEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTL
VETAKEAKEKAKETALAATEKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.