HPA005701

PRELID1 antibody from Sigma-Aldrich
CGI-106, PRELI, PX19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005701
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005701, RRID:AB_1079721
Product name
Anti-PRELID1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005701
Antibody type
Polyclonal
Antigen
Px19-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVV
EERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAV
QEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTL
VETAKEAKEKAKETALAATEKA
Storage
-20C
Provider Type Product Number
- No reagents -