Antibody data

Product number
H00002984-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002984-M05A, RRID:AB_1575749
Product name
GUCY2C monoclonal antibody (M05A), clone 1E1
Provider product page
Abnova Corporation - H00002984-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GUCY2C.
Antigen sequence
SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAV
NEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSG
DCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYST
FQMYL
Isotype
IgG
Antibody clone number
1E1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -