Antibody data

Product number
ABIN501362
Provider
antibodies-online
Product name
anti-gamma-aminobutyric Acid (GABA) A Receptor, beta 1 (GABRB1) antibody
Provider product page
antibodies-online - ABIN501362
Antibody type
Polyclonal
Antigen
The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the N terminal of human GABRB1
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian
Host
Rabbit
Antigen sequence
TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMI
RLHPD GTVLYGLRIT
Vial size
50 µg
Provider Type Product Number
- No reagents -